Recombinant SARS-CoV-2 Spike RBD(B.1.640.2/IHU) Protein
Product Sizes
100 ug
£395.00
RP02104-100UG
500 ug
£1157.00
RP02104-500UG
1000 ug
£2258.00
RP02104-1000UG
About this Product
- SKU:
- RP02104
- Additional Names:
- Envelope,SARS-CoV-2 Spike RBD (N501Y),Spike,Spike ECD,Spike RBD,Spike S1,Spike S2,Spike S2 ECD,S1-RBD protein,NCP-CoV RBD Protein,novel coronavirus RBD Protein,2019-nCoV RBD Protein,S glycoprotein Subunit1 RBD Protein
- Extra Details:
- The spike protein (S) of coronavirus (CoV) attaches the virus to its cellular receptor, angiotensin-converting enzyme 2 (ACE2). A defined receptor-binding domain (RBD) on S mediates this interaction.The S protein plays key parts in the induction of neutralizing-antibody and T-cell responses, as well as protective immunity.
- Formulation:
- Recombinant SARS-CoV-2(2019-nCoV) Spike RBD(B.1.640.2/IHU)-His Protein is produced by Expi293 cells expression system. The target protein is expressed with sequence (Arg319-Phe541(R346S, N394S, Y449N,
- Immunogen:
- Arg319-Phe541(R346S, N394S, Y449N, E484K, F490S, N501Y)
- Molecular Weight:
- 40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 95 %
- Sequence:
- RVQPTESIVRFPNITNLCPFGEVFNATSFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTSVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNNNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYSPLQSYGFQPTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02104


