Recombinant Human TNFRSF10A/DR4/TRAIL-R1/CD261 Protein
Product Sizes
10 ug
£127.00
RP02082-10UG
20 ug
£157.00
RP02082-20UG
50 ug
£223.00
RP02082-50UG
100 ug
£336.00
RP02082-100UG
500 ug
£937.00
RP02082-500UG
1000 ug
£1478.00
RP02082-1000UG
About this Product
- SKU:
- RP02082
- Additional Names:
- TNFRSF10A,APO2,CD261,DR4,TRAILR-1,TRAILR1
- Extra Details:
- Tumor necrosis factor receptor superfamily member 10A (TNFRSF10A) is also known as TNF-related apoptosis-inducing ligand receptor 1 (TRAIL-R1), Death receptor 4 (DR4), CD261 and APO2, which belongs to TNF superfamily.The expression of apoptosis-inducing TRAIL-R1 and TRAIL-R2 and of the decoy receptors TRAIL-R3 and TRAIL-R4 was systematically studied in all developmental stages of peripheral B cells isolated from the blood and secondary lymphoid organs. Expression of TRAIL-Rs is modulated along development, with highest levels observed in germinal center B cells.
- Formulation:
- Recombinant Human TNFRSF10A/DR4/TRAIL-R1/CD261 Protein is produced by Expi293 expression system. The target protein is expressed with sequence (Ala109-Asn239) of Human TRAIL R1 / DR4 / TNFRSF10A fused
- Immunogen:
- Ala109-Asn239
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ATIKLHDQSIGTQQWEHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSDEEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTPWSDIECVHKESGNGHN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02082
