Recombinant Cynomolgus CD3E&CD3D Protein
Product Sizes
100 ug
£508.00
RP02061-100UG
About this Product
- SKU:
- RP02061
- Additional Names:
- CD3 epsilon&CD3 delta|CD3E&CD3D
- Extra Details:
- Recombinant Cynomolgus CD3E&CD3G Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp20-Arg687 (Q95LI52) & Phe22-Ala105 (Q95LI8) ) of cynomolgus CD3E&CD3D (Accession #Q95LI5.2 & Q95LI8) fused with an Fc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Gln22-Asp117(Q95LI52)&Phe22-Ala105(Q95LI8)
- Molecular Weight:
- 36.9 kDa (CD3E), 35.4 kDa (CD3D)
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDFKIPVEELEDRVFVKCNTSVTWVEGTVGTLLTNNTRLDLGKRILDPRGIYRCNGTDIYKDKESAVQVHYRMCQNCVELDPATLA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02061










