Recombinant Cynomolgus CD3E&CD3G Protein

Product Sizes

100 ug

£508.00

RP02060-100UG

500 ug

£1984.00

RP02060-500UG

1000 ug

£2906.00

RP02060-1000UG

About this Product

SKU:: RP02060
Additional Names:: CD3 epsilon&CD3 gamma|CD3E&CD3G
Extra Details:: T-cell surface glycoprotein CD3 epsilon & CD3 gamma chain, also known as CD3E & CD3G , are single-pass type I membrane proteins.When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain.
Formulation:: Recombinant Human BCMA/TNFRSF17 Protein is produced by mammalian expression system. The target protein is expressed with sequence (Asp20-Arg687 (Q95LI52) & Gln23-Thr113 (Q95LI7) ) of cynomolgus CD3E&C
Immunogen:: Gln22-Asp117(Q95LI52)&Gln23-Thr113(Q95LI7)
Molecular Weight:: 44-46 kDa(CD3E), 46-48 kDa (CD3G)
Physical State:: Lyophilized
Purity:: ≥ 95 % as determined by SDS-PAGE;≥95 %
Sequence:: QDGNEEMGSITQTPYQVSISGTTVILTCSQHLGSEAQWQHNGKNKEDSGDRLFLPEFSEMEQSGYYVCYPRGSNPEDASHHLYLKARVCENCMEMDQSFEENRKLNVYNQEDGSVLLTCHVKNTNITWFKEGKMIDILTAHKNKWNLGSNTKDPRGVYQCKGSKDKSKTLQVYYRMCQNCIELNAAT
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket