Recombinant Human DLL3 Protein
Product Sizes
100 ug
£395.00
RP02041-100UG
About this Product
- SKU:
- RP02041
- Additional Names:
- Delta-like protein 3|DLL3|SCDO1
- Extra Details:
- Recombinant Human CD40L/CD154 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala27-Arg491) of human DLL3 (Accession #Q9NYJ7) fused with His at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, 200 mM Arginine, pH 7.4. Contact us for customized product form or formulation.
- Immunogen:
- Ala27-Arg490
- Molecular Weight:
- 50.4 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02041
