Recombinant Human DLL3 Protein
Product Sizes
100 ug
£395.00
RP02041-100UG
500 ug
£1478.00
RP02041-500UG
1000 ug
£2258.00
RP02041-1000UG
About this Product
- SKU:
- RP02041
- Additional Names:
- Delta-like protein 3|DLL3|SCDO1
- Extra Details:
- Delta-like 3 (Drosophila), also known as DLL3, is a protein which in humans is encoded by the DLL3 gene.Two transcript variants encoding distinct isoforms have been identified for this gene.Mutations in this gene cause the autosomal recessive genetic disorder Jarcho-Levin syndrome.Expression of the gene occurs in Neuroendocrine tumors, which has been targeted as a potential pathway for treatment.
- Formulation:
- Recombinant Human CD40L/CD154 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Ala27-Arg491) of human DLL3 (Accession #Q9NYJ7) fused with His at the N-te
- Immunogen:
- Ala27-Arg490
- Molecular Weight:
- 55-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AGVFELQIHSFGPGPGPGAPRSPCSARLPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPGAPAPDLPLPDGLLQVPFRDAWPGTFSFIIETWREELGDQIGGPAWSLLARVAGRRRLAAGGPWARDIQRAGAWELRFSYRARCEPPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPLVCRAGCSPEHGFCEQPGECRCLEGWTGPLCTVPVSTSSCLSPRGPSSATTGCLVPGPGPCDGNPCANGGSCSETPRSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGASALPAAPPGLRPGDPQR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02041


