Recombinant Cynomolgus TNFRSF17/BCMA/CD269 Protein
Product Sizes
100 ug
£431.00
RP02009-100UG
About this Product
- SKU:
- RP02009
- Additional Names:
- BCMA|TNFRSF17
- Extra Details:
- Recombinant Human Angiopoietin-2/ANGPT2 Protein is produced by mammalian expression system. The target protein is expressed with sequence (Met1-Ala53) of cynomolgus BCMA (Accession #G7Q0I4) fused with an Fc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Met1-Ala53
- Molecular Weight:
- 31.5 kda
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- MLQMARQCSQNEYFDSLLHDCKPCQLRCSSTPPLTCQRYCNASMTNSVKGMNA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02009










