Recombinant Human CD3 delta Protein
Product Sizes
100 ug
£336.00
RP02006-100UG
About this Product
- SKU:
- RP02006
- Additional Names:
- CD3D,CD3-DELTA,IMD19,T3D, IMD19, T3D
- Extra Details:
- Recombinant Human CD3 delta Protein is produced by mammalian expression system. The target protein is expressed with sequence (Phe22-Ala105) of Human CD3 delta (Accession #P04234) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
- Immunogen:
- Phe22-Ala105
- Molecular Weight:
- 10.4 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥95 %
- Sequence:
- FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP02006
