Recombinant Human LRG1(P133S) Protein
Product Sizes
10 ug
£145.00
RP01986-10UG
20 ug
£193.00
RP01986-20UG
50 ug
£264.00
RP01986-50UG
100 ug
£395.00
RP01986-100UG
About this Product
- SKU:
- RP01986
- Additional Names:
- LRG1, LRG,Leucine-rich alpha-2-glycoprotein, LRG
- Extra Details:
- Recombinant Human LRG1(P133S) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Vla36-Gln347 (Pro133Ser) ) of Human LRG1(P133S) (Accession #NP_443204.1) fused with His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Vla36-Gln347 (Pro133Ser)
- Molecular Weight:
- 35.16 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01986
