Recombinant Human LRG1(P133S) Protein
Product Sizes
10 ug
£145.00
RP01986-10UG
20 ug
£193.00
RP01986-20UG
50 ug
£264.00
RP01986-50UG
100 ug
£395.00
RP01986-100UG
500 ug
£1157.00
RP01986-500UG
1000 ug
£1812.00
RP01986-1000UG
About this Product
- SKU:
- RP01986
- Additional Names:
- LRG1, LRG,Leucine-rich alpha-2-glycoprotein, LRG
- Extra Details:
- Diabetic nephropathy (DN) is an important public health concern of increasing proportions and the leading cause of end-stage renal disease (ESRD) in diabetic patients. It is one of the most common long-term microvascular complications of diabetes mellitus that is characterized by proteinuria and glomerular structural changes. LRG1 is a novel pro-angiogenic factors involved in the abnormal angiogenesis and renal fibrosis in DN.
- Formulation:
- Recombinant Human LRG1(P133S) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Vla36-Gln347 (Pro133Ser) ) of Human LRG1(P133S) (Accession #NP_44320
- Immunogen:
- Vla36-Gln347 (Pro133Ser)
- Molecular Weight:
- 45-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VTLSPKDCQVFRSDHGSSISCQPPAEIPGYLPADTVHLAVEFFNLTHLPANLLQGASKLQELHLSSNGLESLSPEFLRPVPQLRVLDLTRNALTGLPSGLFQASATLDTLVLKENQLEVLEVSWLHGLKALGHLDLSGNRLRKLPPGLLANFTLLRTLDLGENQLETLPPDLLRGPLQLERLHLEGNKLQVLGKDLLLPQPDLRYLFLNGNKLARVAAGAFQGLRQLDMLDLSNNSLASVPEGLWASLGQPNWDMRDGFDISGNPWICDQNLSDLYRWLQAQKDKMFSQNDTRCAGPEAVKGQTLLAVAKSQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01986
