Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein
Product Sizes
10 ug
£145.00
RP01985-10UG
20 ug
£193.00
RP01985-20UG
50 ug
£288.00
RP01985-50UG
About this Product
- SKU:
- RP01985
- Additional Names:
- CCL14, NCC2, SCYA14,C-C motif chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible cytokine A14, Cleaved into: HCC-1(3-74), HCC-1(4-74), HCC-1(9-74)
- Extra Details:
- Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly28-Asn93) of Human CCL14/HCC-1/HCC-3(28-93) (Accession #NP_116739.1) fused with His at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly28-Asn93
- Molecular Weight:
- 8.623 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01985
