Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein
Product Sizes
10 ug
£145.00
RP01985-10UG
20 ug
£193.00
RP01985-20UG
50 ug
£288.00
RP01985-50UG
500 ug
£1240.00
RP01985-500UG
1000 ug
£1954.00
RP01985-1000UG
About this Product
- SKU:
- RP01985
- Additional Names:
- CCL14, NCC2, SCYA14,C-C motif chemokine 14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, Small-inducible cytokine A14, Cleaved into: HCC-1(3-74), HCC-1(4-74), HCC-1(9-74)
- Extra Details:
- Chemokine (C-C motif) Ligand 14 (CCL14) is a small cytokine belonging to the CC chemokine family. It isproduced as a protein precursor that is processed to generate a mature active protein containing 74 aminoacids that and is 46% identical in amino acid composition to CCL3 and CCL4. This chemokine is expressed invarious tissues including spleen, bone marrow, liver, muscle, and gut. CCL14 activates monocytes, but does notinduce their chemotaxis. Human CCL14 is located on chromosome 17 within a cluster of other chemokinesbelonging to the CC family.
- Formulation:
- Recombinant Human CCL14/HCC-1/HCC-3(28-93) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly28-Asn93) of Human CCL14/HCC-1/HCC-3(28-93) (Accessi
- Immunogen:
- Gly28-Asn93
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01985
