Recombinant Human AMHR2/MISR2 Protein
Product Sizes
20 ug
£181.00
RP01982-20UG
50 ug
£240.00
RP01982-50UG
100 ug
£353.00
RP01982-100UG
500 ug
£1002.00
RP01982-500UG
1000 ug
£1574.00
RP01982-1000UG
About this Product
- SKU:
- RP01982
- Additional Names:
- AMHR2, AMHR, MISR2,Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, Anti-Muellerian hormone type II receptor, AMH type II receptor, MIS type II receptor, MISRII, MRII
- Extra Details:
- AMHR2, On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators.
- Formulation:
- Recombinant Human AMHR2/MISR2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala17-Ser144) of Human AMHR2/MISR2 (Accession #NP_065434.1) fused wi
- Immunogen:
- Ala17-Ser144
- Molecular Weight:
- 15-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- APPNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01982
