Recombinant Mouse C7orf50(Cholesin) Protein
Product Sizes
10 ug
£145.00
RP01980-10UG
20 ug
£193.00
RP01980-20UG
50 ug
£288.00
RP01980-50UG
100 ug
£431.00
RP01980-100UG
About this Product
- SKU:
- RP01980
- Additional Names:
- C7orf50, 3110082I17Rik,Cholesin, Protein C7orf50
- Extra Details:
- Recombinant Mouse C7orf50(Cholesin) Protein is produced by E. coli expression system. The target protein is expressed with sequence (Met1-Ser195) of Mouse 3110082I17Rik(Cholesin) (Accession #NP_082745.2) fused with His at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Met1-Ser195
- Molecular Weight:
- 22.99 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MAKHKRKGLEGTGKESKRQKITPAEETPRTSEAGPDKETASTLVQEASPELSPEERRVLERKLKKERKKEEKKRLREAGIAATQTAKVQTLPAKPSAATLALEYLQGWAQKQESWRFQKTRQTWLLLHMYDEDKVPDEHFPTLLDYLEGLRGSARELTVRKAEALMQKLDEAEPEDSGGSPGKVQRLRQVLQLLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01980
