Skip to content

Basket

You currently have no items in your basket.

Total (excl. vat) £0.00
View basket & checkout
Proteins and Peptides

Recombinant Human CMRF35-like molecule 5/CD300LD Protein

Product Sizes
50 ug
£336.00
RP01979-50UG
100 ug
£508.00
RP01979-100UG
500 ug
£1478.00
RP01979-500UG
1000 ug
£2335.00
RP01979-1000UG
About this Product
SKU:
RP01979
Additional Names:
CD300LD, CD300D, CMRF35A4, UNQ9218/PRO28686,CMRF35-like molecule 5, CLM-5, CD300 antigen-like family member D, CMRF35-A4, CD300d
Extra Details:
CD300d (also known as CD300LD or CMRF35A4) is a member of the CD300 family of transmembrane glycoproteins belonging to the immunoregulatory signaling (IRS) family. CD300d, like most CD300 family members, is found exclusively on myeloid cells, including monocyte and granulocytes . CD300 members contain a V-type immunoglobulin-like domain with an additional pair of cysteine residues in the extracellular domain (ECD), a transmembrane region, and a short cytoplasmic tail . The mature ECD of human CD300d is 146 amino acids (aa) and shares a 48% and 45% identity with mouse and rat CD300d, respectively. CD300d recruits ITAM-bearing Adaptor FceRg. CD300d interacts with all CD300 family members with exception of CD300c, and plays a role in the regulation and/or formation of CD300 complexes on the cell surface and consequently modulate the state of activation of myeloid cells. CD300 family members modulate a broad and diverse array of immune cell processes via their paired activating and inhibitory receptor functions . Mouse CD300d, along with CD300lf, has been identified as a receptor for permissive murine noroviral infection (MNoV) . Further, expression of murine CD300LF on human and other mammalian cell lines confers crossspecies permissively . Additional research into CD300 family member function during viral infections could help develop novel anti-viral therapies .
Formulation:
Recombinant Human CMRF35-like molecule 5/CD300LD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala19-His165) of Human CMRF35-like molecule 5/CD3
Immunogen:
Ala19-His165
Molecular Weight:
45-60 kDa
Physical State:
Lyophilized
Purity:
≥95%
Sequence:
AKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH
Shipping Conditions:
Blue Ice
Storage Conditions:
-20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:
ABclonal Technology
Type:
Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins