Recombinant Human CMRF35-like molecule 5/CD300LD Protein
Product Sizes
50 ug
£336.00
RP01979-50UG
100 ug
£508.00
RP01979-100UG
About this Product
- SKU:
- RP01979
- Additional Names:
- CD300LD, CD300D, CMRF35A4, UNQ9218/PRO28686,CMRF35-like molecule 5, CLM-5, CD300 antigen-like family member D, CMRF35-A4, CD300d
- Extra Details:
- Recombinant Human CMRF35-like molecule 5/CD300LD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala19-His165) of Human CMRF35-like molecule 5/CD300LD (Accession #NP_001108624.1) fused with hFC at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala19-His165
- Molecular Weight:
- 42.07 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AKITGPTTVNGSEQGSLTVQCAYGSGWETYLKWRCQGADWNYCNILVKTNGSEQEVKKNRVSIRDNQKNHVFTVTMENLKRDDADSYWCGTERPGIDLGVKVQVTINPGTQTAVSEWTTTTASLAFTAAATQKTSSPLTRSPLKSTH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01979
