Recombinant Mouse Nkrp1c/NK1.1/CD161c Protein
Product Sizes
20 ug
£193.00
RP01978-20UG
50 ug
£288.00
RP01978-50UG
100 ug
£431.00
RP01978-100UG
500 ug
£1240.00
RP01978-500UG
1000 ug
£1954.00
RP01978-1000UG
About this Product
- SKU:
- RP01978
- Additional Names:
- Klrb1c, Ly55c, Nkrp1c,Killer cell lectin-like receptor subfamily B member 1C, CD161 antigen-like family member C, Lymphocyte antigen 55c, Ly-55c, NK1.1, NKR-P1.9, NKR-P1C, Natural killer cell surface protein P1-40, NKR-P1 40, CD161c
- Extra Details:
- Plays a stimulatory role on natural killer (NK) cells cytotoxicity. Activation by cross-linking of the receptor induces Ca2+ mobilization and interferon-gamma production.
- Formulation:
- Recombinant Mouse Nkrp1c/NK1.1/CD161c Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln67-Ser223) of Mouse Nkrp1c/NK1.1/CD161c (Accession #NP_00
- Immunogen:
- Gln67-Ser223
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQVSNTWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFNSDVLKITGVTENGSCASILGDKVTPESCASDNRWICQKELNHETPSNDS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01978
