Recombinant Human TNF-beta Protein
Product Sizes
10 ug
£133.00
RP01977-10UG
20 ug
£181.00
RP01977-20UG
50 ug
£240.00
RP01977-50UG
100 ug
£353.00
RP01977-100UG
500 ug
£1002.00
RP01977-500UG
1000 ug
£1574.00
RP01977-1000UG
About this Product
- SKU:
- RP01977
- Additional Names:
- LTA, TNFB, TNFSF1,Lymphotoxin-alpha, LT-alpha, TNF-beta, Tumor necrosis factor ligand superfamily member 1
- Extra Details:
- Tumor Necrosis Factor B Beta (TNF- B Beta ) is a secreted protein belonging to the tumor necrosis factor family. TNF- B Betabinds to TNFRSF1A/TNFR1, TNFRSF1B/TNFBR and TNFRSF14/HVEM in homotrimeric form, binds toTNFRSF3/LTBR in heterotrimeric form with LTB. TNF- B Beta forms heterotrimers with lymphotoxin-beta, whichanchors TNF- B Beta to the cell surface. TNF- B Beta mediates the inflammatory, immunostimulatory, and antiviralresponse, involves in the formation of second lymphoid organs during development, has a role in apoptosis.TNF-B Beta is produced by lymphocytes and cytotoxic for a variety of tumor cells in vitro and in vivo.
- Formulation:
- Recombinant Human TNF-beta Protein is produced by CHO Cells expression system. The target protein is expressed with sequence (Leu35-Leu205) of Human TNF-beta(Accession #NP_000586.2) fused with His at
- Immunogen:
- Leu35-Leu205
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LPGVGLTPSAAQTARQHPKMHLAHSTLKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAYSPKATSSPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQLSTHTDGIPHLVLSPSTVFFGAFAL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01977
