Recombinant Mouse IFN-alpha 7/IFNA7 Protein
Product Sizes
10 ug
£133.00
RP01975-10UG
20 ug
£181.00
RP01975-20UG
50 ug
£240.00
RP01975-50UG
100 ug
£353.00
RP01975-100UG
About this Product
- SKU:
- RP01975
- Additional Names:
- Ifna7, If1ai9, Ifna14, Interferon 1ai9, Interferon alpha 7
- Extra Details:
- Recombinant Mouse IFN-alpha 7/IFNA7 Protein is produced by HEK293 cells system. The target protein is expressed with sequence (Cys24-Glu190) of Mouse IFN-alpha 7/IFNA7(Accession #P06799) fused with His at the C-Terminus.
- Formulation:
- Lyophilized from 0.22um filtered solution in PBS (pH 7.4).
- Immunogen:
- Cys24-Glu190
- Molecular Weight:
- 19.86 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CDLPQTHNLRNKRALTLLVKMRRLSPLSCLKDRKDFGFPQAKVDAQQIQEAQAIPVLSELTQQILNIFTSKDSSAAWNATLLDSVCNDLHQQLNDLQGCLMQEVGVQELSLTQEDSLLAVRKYFHRITVFLREKKHSPCAWEVVRAEIWRALSSSANLLARLSEKKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01975
