Recombinant Mouse Orosomucoid-1/ORM1 Protein
Product Sizes
10 ug
£145.00
RP01968-10UG
20 ug
£193.00
RP01968-20UG
50 ug
£288.00
RP01968-50UG
100 ug
£431.00
RP01968-100UG
About this Product
- SKU:
- RP01968
- Additional Names:
- Orm1,Agp1, Orm-1,Agp-1,Agp-2, Orm-1,Alpha-1-acid glycoprotein 1,AGP 1,Orosomucoid-1 (OMD 1)
- Extra Details:
- Recombinant Mouse Orosomucoid-1/ORM1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln19-207Ala) of Mouse Orosomucoid-1/ORM1(Accession #NP_032794.1) fused with His at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln19-207Ala
- Molecular Weight:
- 22.76 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QNPEHANFTIGEPITNETLSWLSDKWFFMGAAFRKLEYRQAIQTMQSEFFYLTTNLINDTIELRESQTIGDQCVYNSTHLGFQRENGTFSKYEGGVETFAHLIVLRKHGAFMLAFDLKDEKKRGLSLYAKRPDITPELREVFQKAVTHVGMDESEIIFVDWKKDRCGQQEKKQLELGKETKKDPEEGQA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01968
