Recombinant Human CCL15/MIP-5/HCC-2 Protein
Product Sizes
10 ug
£145.00
RP01966-10UG
20 ug
£193.00
RP01966-20UG
50 ug
£288.00
RP01966-50UG
100 ug
£431.00
RP01966-100UG
About this Product
- SKU:
- RP01966
- Additional Names:
- CCL15, MIP5, NCC3, SCYA15,C-C motif chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage inflammatory protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible cytokine A15, Cleaved into: CCL15(22-92), CCL15(25-92), CCL15(29-92)
- Extra Details:
- Recombinant Human CCL15/MIP-5/HCC-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser46-Ile113) of Human CCL15/MIP-5/HCC-2 (Accession #NP_116741.2) fused with His at the C-terminus.
- Formulation:
- Lyophilized from a 0.2 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser46-Ile113
- Molecular Weight:
- 8.2 KDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01966
