Recombinant Human CCL15/MIP-5/HCC-2 Protein

Product Sizes

10 ug

£145.00

RP01966-10UG

20 ug

£193.00

RP01966-20UG

50 ug

£288.00

RP01966-50UG

100 ug

£431.00

RP01966-100UG

500 ug

£1240.00

RP01966-500UG

1000 ug

£1954.00

RP01966-1000UG

About this Product

SKU:: RP01966
Additional Names:: CCL15, MIP5, NCC3, SCYA15,C-C motif chemokine 15, Chemokine CC-2, HCC-2, Leukotactin-1, LKN-1, MIP-1 delta, Macrophage inflammatory protein 5, MIP-5, Mrp-2b, NCC-3, Small-inducible cytokine A15, Cleaved into: CCL15(22-92), CCL15(25-92), CCL15(29-92)
Extra Details:: Chemokine ligand 15 (CCL15), also known as leukotactin-1, MIP5, MIP1 and HCC-2, is a small cytokine belonging to the C-C chemokine family. CCL15 is prevantly expressed in liver, small intestine, colon, and in certain leukocytes and macrophages of the lung. It is chemotactic for neutrophils, monocytes, and lymphocytes and elicits its effects by binding to cell surface chemokine receptors like CCR1 and CCR3.
Formulation:: Recombinant Human CCL15/MIP-5/HCC-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser46-Ile113) of Human CCL15/MIP-5/HCC-2 (Accession #NP_116741
Immunogen:: Ser46-Ile113
Molecular Weight:: 10-15 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: SFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket