Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein
Product Sizes
10 ug
£145.00
RP01963-10UG
20 ug
£193.00
RP01963-20UG
50 ug
£288.00
RP01963-50UG
100 ug
£431.00
RP01963-100UG
500 ug
£1240.00
RP01963-500UG
1000 ug
£1954.00
RP01963-1000UG
About this Product
- SKU:
- RP01963
- Additional Names:
- ITPRIPL1, KIAA1754L,Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1
- Extra Details:
- ITPRIPL1/KIAA1754L/CD3L1 is a transmembrane protein with broad expression in the testis associated with immune evasion. In fact, ITPRIPL1 is a molecule specifically expressed in immune privileged tissues, "hot" tumors without PD-L1 expression, and non-responding tumors to PD-1 blockade therapy. ITPRIPL1 has been shown to impair T cell function in vitro and in vivo through CD3e with experimental evidence supporting a negative correlation between ITPRIPL1 expression level in antigen-presenting cells and T cell cytotoxicity. ITPRIPL1 was a hypermethylated-low expression gene in breast cancer and acted as an independent biomarker for the prognosis of lung adenocarcinoma by using bioinformatics methods. Thus, targeting the ITPRIPL1-CD3e axis, especially in PD-1 - PD-L1 negative patients, is a promising therapeutic strategy to reduce immune evasion.
- Formulation:
- Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His25-103Gly) of Human ITPRIPL1/KIAA1754L/CD3L1 (Access
- Immunogen:
- His25-103Gly
- Molecular Weight:
- 10-15KDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01963
