Recombinant Human AMHR2/MISR2 Protein
Product Sizes
10 ug
£133.00
RP01962-10UG
20 ug
£181.00
RP01962-20UG
50 ug
£240.00
RP01962-50UG
100 ug
£353.00
RP01962-100UG
About this Product
- SKU:
- RP01962
- Additional Names:
- AMHR2, AMHR, MISR2,Anti-Muellerian hormone type-2 receptor, EC:2.7.11.30, Anti-Muellerian hormone type II receptor, AMH type II receptor, MIS type II receptor, MISRII, MRII
- Extra Details:
- Recombinant Human AMHR2/MISR2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Pro18-Ser144) of Human AMHR2/MISR2(Accession #Q16671) fused with a hFC tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Pro18-Ser144
- Molecular Weight:
- 39.46 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- PNRRTCVFFEAPGVRGSTKTLGELLDTGTELPRAIRCLYSRCCFGIWNLTQDRAQVEMQGCRDSDEPGCESLHCDPSPRAHPSPGSTLFTCSCGTDFCNANYSHLPPPGSPGTPGSQGPQAAPGES
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01962
