Recombinant Human ITPRIPL1/KIAA1754L/CD3L1 Protein
Product Sizes
20 ug
£193.00
RP01961-20UG
50 ug
£288.00
RP01961-50UG
100 ug
£431.00
RP01961-100UG
About this Product
- SKU:
- RP01961
- Additional Names:
- ITPRIPL1, KIAA1754L,Inositol 1,4,5-trisphosphate receptor-interacting protein-like 1
- Extra Details:
- Recombinant HumanITPRIPL1/KIAA1754L/CD3L1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His25-103Gly) of Human ITPRIPL1/KIAA1754L/CD3L1 Protein (Accession #NP_001008949.1) fused with a hFc&His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- His25-103Gly
- Molecular Weight:
- 36.07 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- HPLMVSDRMDLDTLARSRQLEKRMSEEMRLLEMEFEERKRAAEQRQKAENFWTGDTSSDQLVLGKKDMGWPFQADGQEG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01961
