Recombinant Human SLAMF6/NTB-A/CD352 Protein
Product Sizes
10 ug
£133.00
RP01959-10UG
20 ug
£181.00
RP01959-20UG
50 ug
£240.00
RP01959-50UG
100 ug
£353.00
RP01959-100UG
500 ug
£1002.00
RP01959-500UG
1000 ug
£1574.00
RP01959-1000UG
About this Product
- SKU:
- RP01959
- Additional Names:
- SLAMF6, KALI, UNQ6123/PRO20080,SLAM family member 6, Activating NK receptor, NK-T-B-antigen, NTB-A, CD352
- Extra Details:
- SLAM Family Member 6 (SLAMF6) is a 60 kD single-pass type I membrane protein that belongs to the SLAM subgroup of the CD2 family. Human SLAMF6/ NTB-A contains a 205 amino acid extracellular domain (ECD) with one Ig-like V-set and one Ig-like C2-set domain, a 21 amino acid transmembrane segment and an 84 amino acid cytoplasmic domain, with two immunoreceptor tyrosine-based switch motifs. SLAMF6 is a homodimer. SLAMF6 can interact with PTN6 and, upon phosphorylation, with PTN11 and SH2D1A/SAP. Phosphorylation-dependent NTB-A association with SAP is required for full production of IFN- G Gamma by NK cells and independent of EAT-2 binding. It Triggers cytolytic activity only in natural killer cells (NK) expressing high surface densities of natural cytotoxicity receptors. On B cells, NTB-A modulates immunoglobulin class switching and the balance between tolerance and autoimmunity.
- Formulation:
- Recombinant Human SLAMF6/NTB-A/CD352 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Met226) of Human SLAMF6/NTB-A/CD352 (Accession #NP_0011
- Immunogen:
- Gln22-Met226
- Molecular Weight:
- 60-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01959
