Recombinant Human SLAMF6/NTB-A/CD352 Protein
Product Sizes
10 ug
£133.00
RP01959-10UG
20 ug
£181.00
RP01959-20UG
50 ug
£240.00
RP01959-50UG
100 ug
£353.00
RP01959-100UG
About this Product
- SKU:
- RP01959
- Additional Names:
- SLAMF6, KALI, UNQ6123/PRO20080,SLAM family member 6, Activating NK receptor, NK-T-B-antigen, NTB-A, CD352
- Extra Details:
- Recombinant Human SLAMF6/NTB-A/CD352 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Met226) of Human SLAMF6/NTB-A/CD352 (Accession #NP_001171643.1) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln22-Met226
- Molecular Weight:
- 49.07 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWEALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01959
