Recombinant Human Mature MIS/AMH Protein
Product Sizes
10 ug
£264.00
RP01956-10UG
20 ug
£407.00
RP01956-20UG
50 ug
£621.00
RP01956-50UG
100 ug
£966.00
RP01956-100UG
About this Product
- SKU:
- RP01956
- Additional Names:
- Muellerian-inhibiting factor, Anti-Muellerian hormone, AMH, Muellerian-inhibiting substance, MIS,AMH, MIF
- Extra Details:
- Recombinant Human Mature MIS/AMH Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser452-Arg560)of Human Mature MIS/AMH (Accession #NP_000470.2) fused with No Tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50mM acetic acid, pH 3.0.
- Immunogen:
- Ser452-Arg560
- Molecular Weight:
- 12.51 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SAGATAADGPCALRELSVDLRAERSVLIPETYQANNCQGVCGWPQSDRNPRYGNHVVLLLKMQVRGAALARPPCCVPTAYAGKLLISLSEERISAHHVPNMVATECGCR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01956
