Recombinant Human R-spondin-3/ RSPO3 Protein
Product Sizes
10 ug
£145.00
RP01952-10UG
20 ug
£193.00
RP01952-20UG
50 ug
£288.00
RP01952-50UG
100 ug
£431.00
RP01952-100UG
500 ug
£1240.00
RP01952-500UG
1000 ug
£1954.00
RP01952-1000UG
About this Product
- SKU:
- RP01952
- Additional Names:
- RSPO3, PWTSR, THSD2,R-spondin-3, Protein with TSP type-1 repeat, hPWTSR, Roof plate-specific spondin-3, hRspo3, Thrombospondin type-1 domain-containing protein 2
- Extra Details:
- R-spondin 3 (RSPO3) is a member of the R-Spondin (RSPO) family in vertebrates that activate Wnt/beta-catenin signaling, plays a key role in these processes. The RSPO family of secreted Wnt modulators is involved in development and disease and holds therapeutic promise as stem cell growth factors. The four members have high structural homology. RSPO2 and RSPO3 are more potent than RSPO1, whereas RSPO4 is relatively inactive. All RSPO members require Wnt ligands and LRP6 for activity and amplify signaling of Wnt3A, Wnt1, and Wnt7A, suggesting that RSPO proteins are general regulators of canonical Wnt signaling. RSPO3/PCP signaling during gastrulation requires Wnt5a and is transduced via Fz7, Dvl, and JNK. RSPO3 functions by inducing Sdc4-dependent, clathrin-mediated endocytosis. RSPO3 is a novel, evolutionarily conserved angiogenic factor in embryogenesis. RSPO3 has a key role in the interaction between chorion and allantois in labyrinthine development.
- Formulation:
- Recombinant Human R-spondin-3/ RSPO3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-His272)of Human R-spondin-3/ RSPO3 (Accession #NP_11617
- Immunogen:
- Gln22-His272
- Molecular Weight:
- 40-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QNASRGRRQRRMHPNVSQGCQGGCATCSDYNGCLSCKPRLFFALERIGMKQIGVCLSSCPSGYYGTRYPDINKCTKCKADCDTCFNKNFCTKCKSGFYLHLGKCLDNCPEGLEANNHTMECVSIVHCEVSEWNPWSPCTKKGKTCGFKRGTETRVREIIQHPSAKGNLCPPTNETRKCTVQRKKCQKGERGKKGRERKRKKPNKGESKEAIPDSKSLESSKEIPEQRENKQQQKKRKVQDKQKSVSVSTVH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01952
