Recombinant Mouse IL-20 Protein
Product Sizes
10 ug
£145.00
RP01951-10UG
20 ug
£193.00
RP01951-20UG
50 ug
£288.00
RP01951-50UG
100 ug
£431.00
RP01951-100UG
About this Product
- SKU:
- RP01951
- Additional Names:
- Il20, Zcyto10,Interleukin-20, IL-20, Cytokine Zcyto10
- Extra Details:
- Recombinant Mouse IL-20 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Leu176)of Mouse IL-20 (Accession #Q9JKV9) fused with a His tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 20mM PB,500mM NaCl, pH 8.0.
- Immunogen:
- Leu25-Leu176
- Molecular Weight:
- 18.42 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01951
