Recombinant Mouse IL-20 Protein
Product Sizes
10 ug
£145.00
RP01951-10UG
20 ug
£193.00
RP01951-20UG
50 ug
£288.00
RP01951-50UG
100 ug
£431.00
RP01951-100UG
500 ug
£1478.00
RP01951-500UG
1000 ug
£2335.00
RP01951-1000UG
About this Product
- SKU:
- RP01951
- Additional Names:
- Il20, Zcyto10,Interleukin-20, IL-20, Cytokine Zcyto10
- Extra Details:
- Mouse Interleukin 20 (IL-20) was identified by searching sequence databases for translated sequences with a signal sequence and amphipathic helices found in helical cytokines. Based on the human molecule, mouse IL-20 was discovered in a skin library. Mouse IL-20 is synthesized as a 176 amino acid (aa) precursor that contains a 24 aa signal sequence and a 152 aa mature segment. There are no N-linked glycosylation sites and it is doubtful that the native molecule is glycosylated. Although IL-20 is a distant member of the IL-10 family, it functions as a monomer. IL-20 shares less than 40% aa sequence identity with other IL-10 family members. Mouse and human IL-20 are 77% aa identical in the mature segment. IL-20 production has been found in skin and trachea. In particular, activated keratinocytes and, possibly, monocytes are reported to express IL-20. There are two heterodimeric receptor complexes for IL-20. The first complex is composed of IL-20 R alpha and IL-20 R beta. The second complex is composed of IL-22 R and IL-20 R beta. Whereas the IL-22 R/IL-20 R beta complex is shared with IL-24/mda-7, the IL-20 R alpha /IL-20 R beta complex is shared with both IL-19 and IL-24. Little is known about the function of IL-20. It is reported to induce the proliferation of multipotential hematopoietic progenitor cells, direct the differentiation and expansion of keratinocytes, and promote the release of proinflammatory mediators in keratinocytes and other IL-20 receptor expressing cells .
- Formulation:
- Recombinant Mouse IL-20 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu25-Leu176)of Mouse IL-20 (Accession #Q9JKV9) fused with a His tag at th
- Immunogen:
- Leu25-Leu176
- Molecular Weight:
- 15-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LKTLHLGSCVITANLQAIQKEFSEIRDSVQAEDTNIDIRILRTTESLKDIKSLDRCCFLRHLVRFYLDRVFKVYQTPDHHTLRKISSLANSFLIIKKDLSVCHSHMACHCGEEAMEKYNQILSHFIELELQAAVVKALGELGILLRWMEEML
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01951
