Recombinant Human GDF15 Protein
Product Sizes
20 ug
£181.00
RP01950-20UG
100 ug
£353.00
RP01950-100UG
About this Product
- SKU:
- RP01950
- Additional Names:
- GDF15, MIC1, PDF, PLAB, PTGFB, Growth/differentiation factor 15, GDF-15, Macrophage inhibitory cytokine 1, MIC-1, NSAID-activated gene 1 protein, NAG-1, NSAID-regulated gene 1 protein, NRG-1, Placental TGF-beta, Placental bone morphogenetic protein, Prost
- Extra Details:
- Recombinant Human GDF15 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala197-Ile308)of Human GDF15 (Accession #NP_004855.2) fused with a hFc tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala197-Ile308
- Molecular Weight:
- 38.18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01950
