Recombinant Human CCL8/MCP-2 Protein

Product Sizes

10 ug

£145.00

RP01947-10UG

20 ug

£193.00

RP01947-20UG

50 ug

£288.00

RP01947-50UG

100 ug

£431.00

RP01947-100UG

500 ug

£1240.00

RP01947-500UG

1000 ug

£1954.00

RP01947-1000UG

About this Product

SKU:: RP01947
Additional Names:: CCL8, MCP2, SCYA10, SCYA8,C-C motif chemokine 8, HC14, Monocyte chemoattractant protein 2, Monocyte chemotactic protein 2, MCP-2, Small-inducible cytokine A8, Cleaved into: MCP-2(6-76)
Extra Details:: MCP-2 and MCP-3 are two monocyte chemotactic proteins produced by human MG-63 osteosarcoma cells. Both MCP-2 and MCP-3 are members of the C-C family of chemokines and share 62% and 71% amino acid sequence identity, respectively, with MCP-1. MCP-3 also shares 58% amino acid identity with MCP-2. Similarly to other C-C chemokines, all three MCP proteins are monocyte chemoattractants. In addition, the three MCPs can chemoattract activated NK cells as well as CD4+ and CD8+ T lymphocytes.
Formulation:: Recombinant Human CCL8/MCP-2 Protein by Pichia expression system. The target protein is expressed with sequence (Gln24-Pro99) of Human CCL8/MCP-2 (Accession #NP_005614.2) fused with No tag.
Immunogen:: Gln24-Pro99
Molecular Weight:: 10-15 kDa
Physical State:: Lyophilized
Purity:: ≥90%
Sequence:: QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket