Recombinant Human CCL8/MCP-2 Protein
Product Sizes
10 ug
£145.00
RP01947-10UG
20 ug
£193.00
RP01947-20UG
50 ug
£288.00
RP01947-50UG
100 ug
£431.00
RP01947-100UG
About this Product
- SKU:
- RP01947
- Additional Names:
- CCL8, MCP2, SCYA10, SCYA8,C-C motif chemokine 8, HC14, Monocyte chemoattractant protein 2, Monocyte chemotactic protein 2, MCP-2, Small-inducible cytokine A8, Cleaved into: MCP-2(6-76)
- Extra Details:
- Recombinant Human CCL8/MCP-2 Protein by Pichia expression system. The target protein is expressed with sequence (Gln24-Pro99) of Human CCL8/MCP-2 (Accession #NP_005614.2) fused with No tag.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Gln24-Pro99
- Molecular Weight:
- 8.91 kda
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QPDSVSIPITCCFNVINRKIPIQRLESYTRITNIQCPKEAVIFKTKRGKEVCADPKERWVRDSMKHLDQIFQNLKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01947
