Recombinant Human CCL25/TECK Protein
Product Sizes
10 ug
£163.00
RP01945-10UG
20 ug
£223.00
RP01945-20UG
50 ug
£336.00
RP01945-50UG
About this Product
- SKU:
- RP01945
- Additional Names:
- CCL25, SCYA25, TECK,C-C motif chemokine 25, Chemokine TECK, Small-inducible cytokine A25, Thymus-expressed chemokine
- Extra Details:
- Recombinant Human CCL25/TECK Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Leu150) of Human CCL25/TECK(Accession #NP_000726.1&NP_005615.2) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln24-Leu150
- Molecular Weight:
- 15.01 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- QGVFEDCCLAYHYPIGWAVLRRAWTYRIQEVSGSCNLPAAIFYLPKRHRKVCGNPKSREVQRAMKLLDARNKVFAKLHHNTQTFQAGPHAVKKLSSGNSKLSSSKFSNPISSSKRNVSLLISANSGL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01945
