Recombinant Human LH /CGA&LHB Protein
Product Sizes
10 ug
£193.00
RP01942-10UG
20 ug
£288.00
RP01942-20UG
50 ug
£431.00
RP01942-50UG
About this Product
- SKU:
- RP01942
- Additional Names:
- CGA&LHB,Lutropin alpha chain,&Lutropin beta chain,LSH-alpha&LSH-beta, Luteinizing Hormone alpha/beta Heterodimer
- Extra Details:
- Recombinant Human LH /CGA&LHB Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala25-Ser116)& ( Ser21-Leu141) of Human LH /CGA&LHB(Accession #NP_000726.1&NP_000885.1) fused with a Avi&His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- (Ala25-Ser116)& ( Ser21-Leu141)
- Molecular Weight:
- 26.04 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSYNRVTVMGGFKVENHTACHCSTCYYHKS&SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01942
