Recombinant Mouse Placenta growth factor/PLGF/PGF Protein
Product Sizes
10 ug
£163.00
RP01941-10UG
20 ug
£223.00
RP01941-20UG
50 ug
£336.00
RP01941-50UG
100 ug
£508.00
RP01941-100UG
About this Product
- SKU:
- RP01941
- Additional Names:
- Pgf, Plgf,Placenta growth factor, PlGF
- Extra Details:
- Recombinant Mouse Placenta growth factor/PLGF/PGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Pro158) of Mouse Placenta growth factor/PLGF/PGF(Accession #NP_032853.1) fused with a Avi&His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala24-Pro158
- Molecular Weight:
- 18.04 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALSAGNNSTEVEVVPFNEVWGRSYCRPMEKLVYILDEYPDEVSHIFSPSCVLLSRCSGCCGDEGLHCVPIKTANITMQILKIPPNRDPHFYVEMTFSQDVLCECRPILETTKAERRKTKGKRKRSRNSQTEEPHP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01941
