Recombinant Mouse TNFSF15/TL1A Protein
Product Sizes
10 ug
£133.00
RP01936-10UG
About this Product
- SKU:
- RP01936
- Additional Names:
- Tnfsf15, Tl1, Vegi,Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor
- Extra Details:
- Recombinant Recombinant Mouse TNFSF15/TL1A Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ile76-Leu252) of Mouse TNFSF15/TL1A (Accession #NP_796345.3) fused with no tag .
- Formulation:
- Lyophilized from 0.22 um filtered solution in 20mM PB,300mM NaCl (pH 7.0). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Ile76-Leu252
- Molecular Weight:
- 19.90 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ITEERSEPSPQQVYSPPRGKPRAHLTIKKQTPAPHLKNQLSALHWEHDLGMAFTKNGMKYINKSLVIPESGDYFIYSQITFRGTTSVCGDISRGRRPNKPDSITVVITKVADSYPEPARLLTGSKSVCEISNNWFQSLYLGAMFSLEEGDRLMVNVSDISLVDYTKEDKTFFGAFLL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01936
