Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein
Product Sizes
10 ug
£163.00
RP01933-10UG
20 ug
£223.00
RP01933-20UG
50 ug
£336.00
RP01933-50UG
100 ug
£508.00
RP01933-100UG
About this Product
- SKU:
- RP01933
- Additional Names:
- CXCR1, CMKAR1, IL8RA,C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, CDw128a, High affinity interleukin-8 receptor A, IL-8R A, IL-8 receptor type 1, CD181
- Extra Details:
- Recombinant Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys39) of Human CXC-chemokine receptor 1/CXCR1 (Accession #NP_000625.1) fused with hFc tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Met1-Lys39
- Molecular Weight:
- 30.47 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01933
