Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein
Product Sizes
10 ug
£163.00
RP01933-10UG
20 ug
£223.00
RP01933-20UG
50 ug
£336.00
RP01933-50UG
100 ug
£508.00
RP01933-100UG
500 ug
£1478.00
RP01933-500UG
1000 ug
£2335.00
RP01933-1000UG
About this Product
- SKU:
- RP01933
- Additional Names:
- CXCR1, CMKAR1, IL8RA,C-X-C chemokine receptor type 1, CXC-R1, CXCR-1, CDw128a, High affinity interleukin-8 receptor A, IL-8R A, IL-8 receptor type 1, CD181
- Extra Details:
- Human CXC-chemokine receptor 1/CXCR1, Receptor to interleukin-8, which is a powerful neutrophils chemotactic factor .Binding of IL-8 to the receptor causes activation of neutrophils. This response is mediated via a G-protein that activates a phosphatidylinositol-calcium second messenger system.
- Formulation:
- Recombinant Recombinant Human CXC-chemokine receptor 1/CXCR1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Lys39) of Human CXC-chemokine re
- Immunogen:
- Met1-Lys39
- Molecular Weight:
- 45-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MSNITDPQMWDFDDLNFTGMPPADEDYSPCMLETETLNK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01933
