Recombinant Human Mucin-2 /MUC2 Protein

Product Sizes

100 ug

£508.00

RP01931LQ-100UG

500 ug

£1503.00

RP01931LQ-500UG

1000 ug

£2360.00

RP01931LQ-1000UG

About this Product

SKU:: RP01931LQ
Additional Names:: MUC2, SMUC,Mucin-2, MUC-2, Intestinal mucin-2
Extra Details:: MUC2 Coats the epithelia of the intestines, airways, and other mucus membrane-containing organs. Thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces. Major constituent of both the inner and outer mucus layers of the colon and may play a role in excluding bacteria from the inner mucus layer.
Formulation:: Recombinant Human Mucin-2 /MUC2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly858-Thr1259) of Human Mucin-2 /MUC2 (Accession #NP_002448.4) fu
Immunogen:: Gly858-Thr1259
Molecular Weight:: 60-75 kDa
Purity:: ≥90%
Sequence:: TCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSFSIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVVESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNSWKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSCSCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNRSFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGASVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSIT
Shipping Conditions:: Dry Ice
Storage Conditions:: -70[o]C Aliquot. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket