Recombinant Rat IL-18 Protein
Product Sizes
10 ug
£145.00
RP01929-10UG
20 ug
£193.00
RP01929-20UG
50 ug
£288.00
RP01929-50UG
About this Product
- SKU:
- RP01929
- Additional Names:
- Il18, Igif,Interleukin-18, IL-18, Interferon gamma-inducing factor, IFN-gamma-inducing factor, Interleukin-1 gamma, IL-1 gamma
- Extra Details:
- Recombinant Recombinant Rat IL-18 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His37-Ser194) of Rat IL-18 (Accession #NP_062038.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- His37-Ser194
- Molecular Weight:
- 18.96 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- FGRLHCTTAVIRSINDQVLFVDKRNPPVFEDMPDIDRTANESQTRLIIYMYKDSEVRGLAVTLSVKDGRMSTLSCKNKIISFEEMNPPENIDDIKSDLIFFQKRVPGHNKMEFESSLYEGHFLACQKEDDAFKLVLKRKDENGDKSVMFTLTNLHQS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01929
