Recombinant Human MMP-7 Protein
Product Sizes
10 ug
£163.00
RP01928-10UG
20 ug
£223.00
RP01928-20UG
50 ug
£336.00
RP01928-50UG
About this Product
- SKU:
- RP01928
- Additional Names:
- MMP7, MPSL1, PUMP1,Matrilysin, 3.4.24.23, Matrin, Matrix metalloproteinase-7, MMP-7, Pump-1 protease, Uterine metalloproteinase
- Extra Details:
- Recombinant Recombinant Human MMP-7 Protein is produced by CHO Cells expression system. The target protein is expressed with sequence (Met1-Lys267) of Human MMP-7 (Accession #NP_002414.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in 10mM HEPES, 5mM CaCl2,150mM NaCl (pH 7.5). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Met1-Lys267
- Molecular Weight:
- 30.52 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGDPQNFKLSQDDIKGIQKLYGKRSNSRKK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01928
