Recombinant Human IL-25/IL-17E Protein
Product Sizes
10 ug
£145.00
RP01927-10UG
20 ug
£193.00
RP01927-20UG
50 ug
£288.00
RP01927-50UG
100 ug
£431.00
RP01927-100UG
About this Product
- SKU:
- RP01927
- Additional Names:
- IL-17E|IL-25|IL17E|IL25|interleukin 25|Interleukin-17E|interleukin-25
- Extra Details:
- Recombinant Human IL-25/IL-17E Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Tyr33-Gly177) of Human IL-25/IL-17E (Accession #NP_073626.1) fused with a His tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Tyr33-Gly177
- Molecular Weight:
- 17.58 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01927








