Recombinant Mouse Ephrin-B3/EFNB3 Protein
Product Sizes
10 ug
£127.00
RP01926-10UG
20 ug
£175.00
RP01926-20UG
50 ug
£240.00
RP01926-50UG
100 ug
£336.00
RP01926-100UG
About this Product
- SKU:
- RP01926
- Additional Names:
- Ephrin-B3,Efnb3
- Extra Details:
- Recombinant Recombinant Mouse Ephrin-B3/EFNB3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu28-Ala227) of Mouse Ephrin-B3/EFNB3 (Accession #NP_031937.1) fused with hFc tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Leu28-Ala227
- Molecular Weight:
- 47.88 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01926
