Recombinant Mouse Ephrin-B3/EFNB3 Protein

Product Sizes

10 ug

£127.00

RP01926-10UG

20 ug

£175.00

RP01926-20UG

50 ug

£240.00

RP01926-50UG

100 ug

£336.00

RP01926-100UG

500 ug

£1002.00

RP01926-500UG

1000 ug

£1574.00

RP01926-1000UG

About this Product

SKU:: RP01926
Additional Names:: Ephrin-B3,Efnb3
Extra Details:: Ephrin B3 belongs to the ephrin family. Ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. Ephrin B3 is important in brain development as well as in its maintenance. It is especially important for forebrain function since its expression levels were particularly high in several forebrain subregions compared to other brain subregions. Ephrin B3 binds to, and induce the collapse of, commissural axons/growth cones in vitro.
Formulation:: Recombinant Recombinant Mouse Ephrin-B3/EFNB3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu28-Ala227) of Mouse Ephrin-B3/EFNB3 (Accession #N
Immunogen:: Leu28-Ala227
Molecular Weight:: 60 kda
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: SLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket