Recombinant Rat ALK-1/ACVRL1 Protein
Product Sizes
10 ug
£133.00
RP01925-10UG
20 ug
£181.00
RP01925-20UG
50 ug
£240.00
RP01925-50UG
100 ug
£353.00
RP01925-100UG
About this Product
- SKU:
- RP01925
- Additional Names:
- Acvrl1, Acvrlk1,Serine/threonine-protein kinase receptor R3, SKR3, 2.7.11.30, TGF-B superfamily receptor type I, TSR-I
- Extra Details:
- Recombinant Recombinant Rat ALK-1/ACVRL1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Lys21-Ala118) of Rat ALK-1/ACVRL1 (Accession #NP_071886.1) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Lys21-Ala118
- Molecular Weight:
- 36.97 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- KGDLVKPSRGQLVNCTCENPHCKRPICQGAWCTVVLVREQGRHPQVYRGCGSLNQELCLGRPTEFVNHHCCYRSFCNHNVSLMLEATQTPSEEPEVDA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01925
