Recombinant Mouse CXCL4/PF-4 Protein
Product Sizes
10 ug
£145.00
RP01924-10UG
20 ug
£193.00
RP01924-20UG
50 ug
£288.00
RP01924-50UG
100 ug
£431.00
RP01924-100UG
About this Product
- SKU:
- RP01924
- Additional Names:
- Pf4, Cxcl4, Scyb4,Platelet factor 4, PF-4, C-X-C motif chemokine 4
- Extra Details:
- Recombinant Recombinant Mouse CXCL4/PF-4 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Val30-Ser105) of Mouse CXCL4/PF-4 (Accession #NP_064316.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in 20mM pb,150mM Nacl ,1mM EDTA (pH 6.0). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Val30-Ser105
- Molecular Weight:
- 9.04 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01924
