Recombinant Mouse CXCL4/PF-4 Protein
Product Sizes
10 ug
£145.00
RP01924-10UG
20 ug
£193.00
RP01924-20UG
50 ug
£288.00
RP01924-50UG
100 ug
£431.00
RP01924-100UG
500 ug
£1240.00
RP01924-500UG
1000 ug
£1954.00
RP01924-1000UG
About this Product
- SKU:
- RP01924
- Additional Names:
- Pf4, Cxcl4, Scyb4,Platelet factor 4, PF-4, C-X-C motif chemokine 4
- Extra Details:
- CXCL4/PF-4,Chemokine released during platelet aggregation that plays a role in different biological processes including hematopoiesis, cell proliferation, differentiation, and activation. Acts via different functional receptors including CCR1, CXCR3A or CXCR3B. Upon interaction with CXCR3A receptor, induces activated T-lymphocytes migration mediated via downstream Ras/extracellular signal-regulated kinase (ERK) signaling. Neutralizes the anticoagulant effect of heparin by binding more strongly to heparin than to the chondroitin-4-sulfate chains of the carrier molecule. Plays a role in the inhibition of hematopoiesis and in the maintenance of hematopoietic stem cell (HSC) quiescence. Chemotactic for neutrophils and monocytes via CCR1. Inhibits endothelial cell proliferation. In cooperation with toll-like receptor 8/TLR8, induces chromatin remodeling and activates inflammatory gene expression via the TBK1-IRF5 axis. In addition, induces myofibroblast differentiation and collagen synthesis in different precursor cells, including endothelial cells, by stimulating endothelial-to-mesenchymal transition.
- Formulation:
- Recombinant Recombinant Mouse CXCL4/PF-4 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Val30-Ser105) of Mouse CXCL4/PF-4 (Accession #NP_064316.1) fuse
- Immunogen:
- Val30-Ser105
- Molecular Weight:
- 15-20 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- VTSAGPEESDGDLSCVCVKTISSGIHLKHITSLEVIKAGRHCAVPQLIATLKNGRKICLDRQAPLYKKVIKKILES
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01924
