Recombinant Mouse CCL7/MCP-3 Protein
Product Sizes
10 ug
£145.00
RP01923-10UG
20 ug
£193.00
RP01923-20UG
50 ug
£288.00
RP01923-50UG
100 ug
£431.00
RP01923-100UG
About this Product
- SKU:
- RP01923
- Additional Names:
- C-C motif chemokine 7|CCL7|chemokine (C-C motif) ligand 7|FIC|MARC|MCP-3|MCP-3Small-inducible cytokine A7|MCP3Monocyte chemotactic protein 3|MGC138465|Monocyte chemoattractant protein 3|NC28SCYA6|SCYA7MGC138463|small inducible cytokine A7 (monocyte chemotactic protein 3)
- Extra Details:
- Recombinant Mouse CCL7/MCP-3 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gln24-Pro97) of Mouse CCL7/MCP-3 (Accession #NP_038682.1) fused with a his tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln24-Pro97
- Molecular Weight:
- 9.35 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QPDGPNASTCCYVKKQKIPKRNLKSYRRITSSRCPWEAVIFKTKKGMEVCAEAHQKWVEEAIAYLDMKTPTPKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01923
