Recombinant Rat TNFRSF17/BCMA/CD269 Protein
Product Sizes
10 ug
£133.00
RP01922-10UG
20 ug
£181.00
RP01922-20UG
50 ug
£240.00
RP01922-50UG
100 ug
£353.00
RP01922-100UG
About this Product
- SKU:
- RP01922
- Additional Names:
- Tnfrsf17,TNF receptor superfamily member 17
- Extra Details:
- Recombinant Recombinant Rat TNFRSF17/BCMA/CD269 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Thr49) of Rat TNFRSF17/BCMA/CD269 (Accession #NP_001099231.1) fused with a hFc tag at the N-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Met1-Thr49
- Molecular Weight:
- 31.52 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- MAQRCFHSEYFDSLLHACKPCRLRCSNPPAPCQPYCDPSMTSSVRGTYT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01922
