Recombinant Rat CXCL1/GRO-alpha Protein
Product Sizes
10 ug
£145.00
RP01917-10UG
20 ug
£193.00
RP01917-20UG
50 ug
£288.00
RP01917-50UG
100 ug
£431.00
RP01917-100UG
500 ug
£1240.00
RP01917-500UG
1000 ug
£1954.00
RP01917-1000UG
About this Product
- SKU:
- RP01917
- Additional Names:
- C-X-C motif chemokine 1|CINC-1|CINC-1,rRtGRO-A Alpha/CXCL1|Gro1|Growth-regulated alpha protein
- Extra Details:
- CXCL1, also known as KC, GRO alpha, and CINC-1, is an approximately 8 kDa proinflammatory chemokine that plays a key role in neutrophil migration and activation. Mature human CXCL1 shares 64% and 67% aa sequence identity with mouse and rat CXCL1, respectively. It is produced by many cell types in inflammatory sites and during chronic inflammatory diseases. CXCL1 can associate into bioactive dimers and primarily signals through CXCR2/IL-8 RB but can also bind with lower affinity to CXCR2/IL-8 RA. It induces neutrophil migration, extravasation, respiratory burst, and degranulation and also induces T cells to produce proinflammatory IL-17. CXCL1 additionally binds to Syndecan-1 on epithelial cells which acts as a sink for CXCL1 activity until Syndecan-1 cleavage by MMP-7. CXCL1 is up-regulated in spinal cord astrocytes by inflammatory stimuli or tumor cell injection, and it exacerbates pain sensation by potentiating excitatory NMDA neurotransmission. In the circulatory system, CXCL1 interacts with CXCR2 on endothelial cells to promote lymphatic tube formation and angiogenesis . It promotes the hypertrophic differentiation of chondrocytes resulting in cartilage matrix deposition, calcification, and remodeling. It interacts with both CXCR1 and CXCR2 on adipose stromal cells and promotes their recruitment to prostate tumors in obese patients.. It also binds CXCR2 on ovarian cancer cells, leading to cleavage of cell surface HB-EGF, transactivation of EGF R, and cell proliferation.
- Formulation:
- Recombinant Rat CXCL1/GRO-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Lys96) of Rat CXCL1/GRO-alpha (Accession #NP_110472.1) fused
- Immunogen:
- Gly24-Lys96
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GAPVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01917
