Recombinant Rat CXCL1/GRO-alpha Protein
Product Sizes
10 ug
£145.00
RP01917-10UG
20 ug
£193.00
RP01917-20UG
50 ug
£288.00
RP01917-50UG
100 ug
£431.00
RP01917-100UG
About this Product
- SKU:
- RP01917
- Additional Names:
- C-X-C motif chemokine 1|CINC-1|CINC-1,rRtGRO-A Alpha/CXCL1|Gro1|Growth-regulated alpha protein
- Extra Details:
- Recombinant Rat CXCL1/GRO-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Lys96) of Rat CXCL1/GRO-alpha (Accession #NP_110472.1) fused with a Avi-His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly24-Lys96
- Molecular Weight:
- 10.56 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GAPVANELRCQCLQTVAGIHFKNIQSLKVMPPGPHCTQTEVIATLKNGREACLDPEAPMVQKIVQKMLKGVPK
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01917




