Recombinant Mouse TNFSF8/CD30 Ligand/CD153 Protein
Product Sizes
10 ug
£145.00
RP01916-10UG
20 ug
£193.00
RP01916-20UG
50 ug
£288.00
RP01916-50UG
100 ug
£431.00
RP01916-100UG
About this Product
- SKU:
- RP01916
- Additional Names:
- CD153|CD153 antigen|CD30 antigen ligand|CD30 Ligand|CD30-L|CD30L|CD30LCD30 ligand|CD30LGMGC138144|TNFSF8|tumor necrosis factor (ligand) superfamily, member 8|tumor necrosis factor ligand superfamily member 8
- Extra Details:
- Recombinant Mouse TNFSF8/CD30 Ligand Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser103-ASP239) of Mouse TNFSF8/CD30 Ligand (Accession #NP_033429.1) fused with a His tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser103-ASP239
- Molecular Weight:
- 16.51 kDa
- Physical State:
- Lyophilized
- Purity:
- 85%
- Sequence:
- SWAYLQVSKHLNNTKLSWNEDGTIHGLIYQDGNLIVQFPGLYFIVCQLQFLVQCSNHSVDLTLQLLINSKIKKQTLVTVCESGVQSKNIYQNLSQFLLHYLQVNSTISVRVDNFQYVDTNTFPLDNVLSVFLYSSSD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01916
