Recombinant Human IFN-alpha G/IFNA5 Protein
Product Sizes
10 ug
£133.00
RP01915-10UG
20 ug
£181.00
RP01915-20UG
50 ug
£240.00
RP01915-50UG
100 ug
£353.00
RP01915-100UG
500 ug
£1002.00
RP01915-500UG
1000 ug
£1574.00
RP01915-1000UG
About this Product
- SKU:
- RP01915
- Additional Names:
- Ifa5|IFN-alpha G|IFN-alpha-5|IFN-alphaG|IFNA5|IFNalpha G|INFA5|interferon alpha-5|Interferon alpha-61|Interferon alpha-G|interferon, alpha 5|LeIF G
- Extra Details:
- Interferon, alpha 5 (IFNA5) belongs to the alpha/beta interferon family. IFNA5 is the only IFNA subtype detected in normal liver, while a mixture of subtypes is observed in the liver tissue of patients with chronic hepatitis C. Interferons are produced by macrophages, IFN-alpha has antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase. IFN-alpha, the first cytokine to be produced by recombinant DNA technology, has emerged as an important regulator of growth and differentiation, affecting cellular communication and signal transduction pathways as well as immunological control. Originally discovered as an antiviral substance, the efficacy of IFN-alpha in malignant, viral, immunological, angiogenic, inflammatory, and fibrotic diseases suggests a spectrum of interrelated pathophysiologies. IFN-alpha emerged as a prototypic tumor suppressor protein that represses the clinical tumorigenic phenotype in some malignancies capable of differentiation.
- Formulation:
- Recombinant Human interferon-alpha/IFNA5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu22-Glu189) of Human interferon-alpha/IFNA5 (Accession
- Immunogen:
- Leu22-Glu189
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- LGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01915
