Recombinant Human IFN-alpha G/IFNA5 Protein
Product Sizes
10 ug
£133.00
RP01915-10UG
20 ug
£181.00
RP01915-20UG
50 ug
£240.00
RP01915-50UG
100 ug
£353.00
RP01915-100UG
About this Product
- SKU:
- RP01915
- Additional Names:
- Ifa5|IFN-alpha G|IFN-alpha-5|IFN-alphaG|IFNA5|IFNalpha G|INFA5|interferon alpha-5|Interferon alpha-61|Interferon alpha-G|interferon, alpha 5|LeIF G
- Extra Details:
- Recombinant Human interferon-alpha/IFNA5 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu22-Glu189) of Human interferon-alpha/IFNA5 (Accession #NP_002160.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu22-Glu189
- Molecular Weight:
- 20.53 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- LGCDLPQTHSLSNRRTLMIMAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWDETLLDKFYTELYQQLNDLEACMMQEVGVEDTPLMNVDSILTVRKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSANLQERLRRKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01915
