Recombinant Human Lutropin beta chain/LHB Protein
Product Sizes
10 ug
£163.00
RP01911-10UG
20 ug
£223.00
RP01911-20UG
50 ug
£336.00
RP01911-50UG
100 ug
£508.00
RP01911-100UG
About this Product
- SKU:
- RP01911
- Additional Names:
- LHB,Lutropin subunit beta, Lutropin beta chain, Luteinizing hormone subunit beta, LH-B, LSH-B, LSH-beta
- Extra Details:
- Recombinant Human Lutropin beta chain/LHB Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Leu141) of Human LHB (Accession #NP_000885.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Ser21-Leu141
- Molecular Weight:
- 14.04 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01911
