Recombinant Mouse TNFSF13B/BAFF/CD257 Protein
Product Sizes
10 ug
£133.00
RP01909-10UG
20 ug
£181.00
RP01909-20UG
50 ug
£240.00
RP01909-50UG
About this Product
- SKU:
- RP01909
- Additional Names:
- Tnfsf13b, Baff, Tumor necrosis factor ligand superfamily member 13B, B-cell-activating factor, BAFF, CD257, Cleaved into: Tumor necrosis factor ligand superfamily member 13b, membrane form, Tumor necrosis factor ligand superfamily member 13b, soluble form
- Extra Details:
- Recombinant Mouse TNFSF13B/BAFF/CD257 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala127-Leu309) of Mouse TNFSF13B/BAFF/CD257 (Accession #NP_296371.1) fused with a His and a hFc tag at the N-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala127-Leu309
- Molecular Weight:
- 47.41 kDa
- Physical State:
- Lyophilized
- Purity:
- 85%
- Sequence:
- AFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLFRCIQNMPKTLPNNSCYSAGIARLEEGDEIQLAIPRENAQISRNGDDTFFGALKLL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01909
