Recombinant Mouse CCL4/MIP-1B Beta Protein
Product Sizes
10 ug
£145.00
RP01907-10UG
20 ug
£193.00
RP01907-20UG
50 ug
£288.00
RP01907-50UG
100 ug
£431.00
RP01907-100UG
500 ug
£1240.00
RP01907-500UG
1000 ug
£1954.00
RP01907-1000UG
About this Product
- SKU:
- RP01907
- Additional Names:
- Ccl4, Mip1b, Scya4,C-C motif chemokine 4, Immune activation protein 2, ACT-2, ACT2, Macrophage inflammatory protein 1-beta, MIP-1-beta, Protein H400, SIS-gamma, Small-inducible cytokine A4
- Extra Details:
- CCL4, also known as macrophage inflammatory protein 1 beta (MIP-1 beta ), is a 12 kDa beta chemokine that is secreted at sites of inflammation by activated leukocytes, lymphocytes, vascular endothelial cells, and pulmonary smooth muscle cells. CCL4 attracts a variety of immune cells to sites of microbial infection as well as to other pathologic inflammation such as allergic asthma and ischemic myocardium . A CCL4 deficiency in mice promotes the development of autoantibodies, possibly as a result of compromised regulatory T cell recruitment . CCL4 is secreted from activated monocytes as a heterodimer with CCL3/MIP-1 alpha . The first two N-terminal amino acids can be cleaved from human CCL4 by CD26/DPPIV . Both the full length and truncated forms exert biological activity through CCR5, Both forms of CCL4 block HIV-1 infection of T cells by inducing the downregulation of CCR5.
- Formulation:
- Recombinant Recombinant Mouse CCL4/MIP-1B Beta Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala24-Asn92) of Mouse CCL4/MIP-1B Beta (Accession #NP_038
- Immunogen:
- Ala24-Asn92
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01907
