Recombinant Mouse CCL4/MIP-1B Beta Protein
Product Sizes
10 ug
£145.00
RP01907-10UG
20 ug
£193.00
RP01907-20UG
50 ug
£288.00
RP01907-50UG
100 ug
£431.00
RP01907-100UG
About this Product
- SKU:
- RP01907
- Additional Names:
- Ccl4, Mip1b, Scya4,C-C motif chemokine 4, Immune activation protein 2, ACT-2, ACT2, Macrophage inflammatory protein 1-beta, MIP-1-beta, Protein H400, SIS-gamma, Small-inducible cytokine A4
- Extra Details:
- Recombinant Recombinant Mouse CCL4/MIP-1B Beta Protein is produced by Pichia expression system. The target protein is expressed with sequence (Ala24-Asn92) of Mouse CCL4/MIP-1B Beta (Accession #NP_038680.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Ala24-Asn92
- Molecular Weight:
- 8.67 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- APMGSDPPTSCCFSYTSRQLHRSFVMDYYETSSLCSKPAVVFLTKRGRQICANPSEPWVTEYMSDLELN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01907
