Recombinant Mouse CCL22/MDC Protein
Product Sizes
10 ug
£133.00
RP01906-10UG
20 ug
£181.00
RP01906-20UG
50 ug
£240.00
RP01906-50UG
100 ug
£353.00
RP01906-100UG
About this Product
- SKU:
- RP01906
- Additional Names:
- Ccl22, Abcd1, Scya22,C-C motif chemokine 22, Activated B and dendritic cell-derived, CC chemokine ABCD-1, Small-inducible cytokine A22
- Extra Details:
- Recombinant Mouse CCL22/MDC Protein by Pichia expression system. The target protein is expressed with sequence (Gly25-Ser92) of Mouse CCL22/MDC (Accession #NP_033163.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS, 0.2 M Arginine, pH7.4. Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- Gly25-Ser92
- Molecular Weight:
- 8.68 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01906
