Recombinant Mouse CCL22/MDC Protein
Product Sizes
10 ug
£133.00
RP01906-10UG
20 ug
£181.00
RP01906-20UG
50 ug
£240.00
RP01906-50UG
100 ug
£353.00
RP01906-100UG
500 ug
£1002.00
RP01906-500UG
1000 ug
£1574.00
RP01906-1000UG
About this Product
- SKU:
- RP01906
- Additional Names:
- Ccl22, Abcd1, Scya22,C-C motif chemokine 22, Activated B and dendritic cell-derived, CC chemokine ABCD-1, Small-inducible cytokine A22
- Extra Details:
- CCL22 may play a role in the trafficking of activated/effector T-lymphocytes to inflammatory sites and other aspects of activated T-lymphocyte physiology. Also, it is a chemotactic for monocytes. dendritic cells and natural killer cells. CCL22 is a mild chemoattractant for primary activated T-lymphocytes and a potent chemoattractant for chronically activated T-lymphocytes but has no chemattractant activity for neutrophils, eosinophils, and resting T-lymphocytes.
- Formulation:
- Recombinant Mouse CCL22/MDC Protein by Pichia expression system. The target protein is expressed with sequence (Gly25-Ser92) of Mouse CCL22/MDC (Accession #NP_033163.1) fused with a His tag at the C-t
- Immunogen:
- Gly25-Ser92
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- GPYGANVEDSICCQDYIRHPLPSRLVKEFFWTSKSCRKPGVVLITVKNRDICADPRQVWVKKLLHKLS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01906
