Recombinant Mouse CCL11/Eotaxin Protein
Product Sizes
10 ug
£145.00
RP01904-10UG
20 ug
£193.00
RP01904-20UG
50 ug
£288.00
RP01904-50UG
100 ug
£431.00
RP01904-100UG
About this Product
- SKU:
- RP01904
- Additional Names:
- Ccl11, Scya11,Eotaxin, C-C motif chemokine 11, Eosinophil chemotactic protein, Small-inducible cytokine A11
- Extra Details:
- Recombinant Mouse CCL11/Eotaxin Protein by Pichia expression system. The target protein is expressed with sequence (His24-Pro97) of Mouse CCL11/Eotaxin (Accession #NP_035460.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from 0.22 um filtered solution in PBS,250mM NaCl,pH 7.4. Normally 8% trehalose is added as protectant before lyophilization.
- Immunogen:
- His24-Pro97
- Molecular Weight:
- 9.28 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HPGSIPTSCCFIMTSKKIPNTLLKSYKRITNNRCTLKAIVFKTRLGKEICADPKKKWVQDATKHLDQKLQTPKP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01904
