Recombinant Rat Thrombopoietin /THPO / TPO Protein
Product Sizes
10 ug
£163.00
RP01901-10UG
20 ug
£223.00
RP01901-20UG
50 ug
£336.00
RP01901-50UG
100 ug
£508.00
RP01901-100UG
500 ug
£1478.00
RP01901-500UG
1000 ug
£2335.00
RP01901-1000UG
About this Product
- SKU:
- RP01901
- Additional Names:
- Megakaryocyte colony-stimulating factor|Megakaryocyte growth and development factor|megakaryocyte stimulating factor|MGDF|MGDFC-mpl ligand|MK-CSF|MKCSF|ML|MPL ligand|MPLLG|MPLLGMGC163194|Myeloproliferative leukemia virus oncogene ligand|THCYT1|THPO|Thrombopoietin|thrombopoietin nirs variant 1|Tpo|TPOMKCSF
- Extra Details:
- Thrombopoietin (Tpo), is a key regulator of megakaryocytopoiesis and thrombopoiesis. It is principally produced in the liver and is bound and internalized by the receptor Tpo R/cmpl. Defects in the TpoTpo R signaling pathway are associated with a variety of platelet disorders . Mature rat Tpo shares 68% and 81% aa sequence homology with human and mouse Tpo, respectively . It is an 8085 kDa protein that consists of an Nterminal domain with homology to Erythropoietin (Epo) and a Cterminal domain that contains multiple Nlinked and Olinked glycosylation sites. Tpo promotes the differentiation, proliferation, and maturation of megakaryocytes (MK) and their progenitors . Several other cytokines can also promote these functions but only in cooperation with Tpo . Notably, IL3 independently induces MK development, although its effects are restricted to early in the MK lineage . Tpo additionally promotes platelet production, aggregation, ECM adhesion, and activation . These actions, in combination with direct effects on cardiomyocytes, can aid in the recovery of heart function following myocardial infarction . Tpo is cleaved by plateletderived thrombin following Arg191 within the Cterminal domain and subsequently at other sites upon extended digestion . The Cterminal domain is not required for binding to Tpo R or inducing MK growth and differentiation . Aside from its hematopoietic effects, Tpo is expressed in the brain where it promotes the apoptosis of hypoxiasensitized neurons and inhibits neuronal differentiation by blocking NGFinduced signaling .
- Formulation:
- Recombinant Rat THPO / TPO / Thrombopoietin Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Ser326) of Rat THPO / TPO / Thrombopoietin (Acce
- Immunogen:
- Ser22-Ser326
- Molecular Weight:
- 50-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKFPNRTSGLLETNFSVVARTAGPGLLNRLQGFRAKIIPGQLNQTSGSLDQIPGYLNGTHEPVNGTHGLFAGTSLQTLEAPDVVPGAFNKGSLPLNLQSGLPPIPSLAADGYTLFPPSPTFPTPGSPPQLPPVS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01901
