Recombinant Rat Thrombopoietin /THPO / TPO Protein
Product Sizes
10 ug
£163.00
RP01901-10UG
20 ug
£223.00
RP01901-20UG
50 ug
£336.00
RP01901-50UG
100 ug
£508.00
RP01901-100UG
About this Product
- SKU:
- RP01901
- Additional Names:
- Megakaryocyte colony-stimulating factor|Megakaryocyte growth and development factor|megakaryocyte stimulating factor|MGDF|MGDFC-mpl ligand|MK-CSF|MKCSF|ML|MPL ligand|MPLLG|MPLLGMGC163194|Myeloproliferative leukemia virus oncogene ligand|THCYT1|THPO|Thrombopoietin|thrombopoietin nirs variant 1|Tpo|TPOMKCSF
- Extra Details:
- Recombinant Rat THPO / TPO / Thrombopoietin Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser22-Ser326) of Rat THPO / TPO / Thrombopoietin (Accession #NP_112395.1) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser22-Ser326
- Molecular Weight:
- 33.10 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SPVPPACDPRLLNKLLRDSYLLHSRLSQCPDVNPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPPQGRTTAHKDPSALFLSLQQLLRGKVRFLLLVEGPALCVRRTLPTTAVPSRTSQLLTLNKFPNRTSGLLETNFSVVARTAGPGLLNRLQGFRAKIIPGQLNQTSGSLDQIPGYLNGTHEPVNGTHGLFAGTSLQTLEAPDVVPGAFNKGSLPLNLQSGLPPIPSLAADGYTLFPPSPTFPTPGSPPQLPPVS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01901




