Recombinant Human IFN-alpha 21 Protein
Product Sizes
10 ug
£145.00
RP01900-10UG
20 ug
£193.00
RP01900-20UG
50 ug
£288.00
RP01900-50UG
About this Product
- SKU:
- RP01900
- Additional Names:
- IFN-alpha 21|IFN-alpha F|IFN-alpha-21|IFN-alphaI|IFNA21|IFNalpha F|interferon alpha-21|Interferon alpha-F|interferon, alpha 21|LeIF F|leukocyte interferon protein|MGC126687|MGC126689
- Extra Details:
- Recombinant Human IFN-alpha 21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Glu189) of Human IFN-alpha 21/IFNA21 (Accession #NP_002166.2) fused with a His tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Cys24-Glu189
- Molecular Weight:
- 20.15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01900
