Recombinant Human IFN-alpha 21 Protein
Product Sizes
10 ug
£145.00
RP01900-10UG
20 ug
£193.00
RP01900-20UG
50 ug
£288.00
RP01900-50UG
500 ug
£1240.00
RP01900-500UG
1000 ug
£1954.00
RP01900-1000UG
About this Product
- SKU:
- RP01900
- Additional Names:
- IFN-alpha 21|IFN-alpha F|IFN-alpha-21|IFN-alphaI|IFNA21|IFNalpha F|interferon alpha-21|Interferon alpha-F|interferon, alpha 21|LeIF F|leukocyte interferon protein|MGC126687|MGC126689
- Extra Details:
- Interferons (IFN) are a family of cytokines with potent antiviral, anti-proliferative and immunomodulatory properties, classified based on their binding specificity to cell surface receptors. Human IFNA2 was originally cloned in the early '80s and now more than a dozen closely related IFN alpha subtypes have been identified in both the human and mouse genome, each sharing about 80% amino acid (aa) sequence homology . Structurally, type I IFNs belong to the class of five helicalbundle cytokines, with the IFNA subtypes containing 2 conserved disulfide bonds . There is not a mouse homolog for IFNA21, but mature human IFNA21 is identical to chimpanzee IFNA21. The type I IFNs bind to the interferon alpha receptor (IFNAR), which consists of two subunits: IFNAR1 (alpha -subunit) and IFNAR2 (beta -subunit) . Individual IFNA subtypes are known to display unique efficacies to viral protection, with IFNA21 displaying intermediate activity inducing interferon stimulating genes. Further, human IFNA21 has shown weak anti-viral activity against viruses such as metapneumovirus .
- Formulation:
- Recombinant Human IFN-alpha 21 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Glu189) of Human IFN-alpha 21/IFNA21 (Accession #NP_002166.2)
- Immunogen:
- Cys24-Glu189
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- CDLPQTHSLGNRRALILLAQMGRISPFSCLKDRHDFGFPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTKDSSATWEQSLLEKFSTELNQQLNDLEACVIQEVGVEETPLMNVDSILAVKKYFQRITLYLTEKKYSPCAWEVVRAEIMRSFSLSKIFQERLRRKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01900
